HORDB

General Information

ID: hor006517
Uniprot ID: P01048
Protein name: T-kininogen 1 light chain
Gene name: Map1
Organism: Rattus norvegicus (Rat)
Family: NA
Source: animal
Expression: In response to an inflammatory stimulant. T-kininogen II synthesis is induced and the plasma concentration of T-kininogen I is raised.|Plasma.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
GO BP: GO:0006953 acute-phase response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0030195 negative regulation of blood coagulation; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence Information

Sequence: LVRVQETKEGTTRLLNSCEYKGRLSKARAGPAPDHQAEASTVTP
Length: 44
Propeptide: MKLITILLLCSRLLPSLAQEEGAQELNCNDETVFQAVDTALKKYNAELESGNQFVLYRVTEGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSVATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALREVKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPSLREDCVPLPYGDHGECTGHTHVDIHNTIAGFSQSCDLYPGDDLFELLPKNCRGCPREIPVDSPELKEALGHSIAQLNAQHNHIFYFKIDTVKKATSQVVAGVIYVIEFIARETNCSKQSKTELTADCETKHLGQSLNCNANVYMRPWENKVVPTVRCQALDMMISRPPGFSPFRLVRVQETKEGTTRLLNSCEYKGRLSKARAGPAPDHQAEASTVTP
Signal peptide: MKLITILLLCSRLLPSLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Kininogens are plasma glycoproteins with a number of functions: (1) as precursor of the active peptide bradykinin they effect smooth muscle contraction, induction of hypotension and increase of vascular permeability. (2) They play a role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII. (3) They are inhibitor of thiol proteases.
Mechanism: Rats express four types of kininogens: the classical HMW and LMW kininogens produced by alternative splicing of the same gene, and two additional LMW-like kininogens: T-I and T-II.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01048-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006517_AF2.pdb

hor006517_ESM.pdb

Physical Information

Mass:	553451	Formula:	C202H338N64O67S
Absent amino acids:	FIMW	Common amino acids:	AT
pI:	9.37	Basic residues:	8
Polar residues:	14	Hydrophobic residues:	12
Hydrophobicity:	-79.09	Boman Index:	-11291
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	66.59
Instability Index:	2260.68	Extinction Coefficient cystines:	1490
Absorbance 280nm:	34.65

Literature

PubMed ID: 2413018
Title: Primary structures of the mRNAs encoding the rat precursors for bradykinin and T-kinin. Structural relationship of kininogens with major acute phase protein and alpha 1-cysteine proteinase inhibitor.
PubMed ID: 2806908
Title: Primary structure of a gene encoding rat T-kininogen.
PubMed ID: 2439509
Title: Structure and expression of the genes for major acute phase alpha 1-protein (thiostatin) and kininogen in the rat.
PubMed ID: 3818598
Title: Differing utilization of homologous transcription initiation sites of rat K and T kininogen genes under inflammation condition.
PubMed ID: 2578992
Title: Major acute phase alpha 1-protein of the rat is homologous to bovine kininogen and contains the sequence for bradykinin: its synthesis is regulated at the mRNA level.
PubMed ID: 3121623
Title: Purification and characterization of rat T-kininogens isolated from plasma of adjuvant-treated rats. Identification of three kinds of T-kininogens.
PubMed ID: 2108948
Title: Identification of a protein increasing in serum of Nagase analbuminemic rats bearing intestinal tumors as an isotype of T-kininogen.
PubMed ID: 7574705
Title: Identification of several isoforms of T-kininogen expressed in the liver of aging rats.
PubMed ID: 3029068
Title: Differing expression patterns and evolution of the rat kininogen gene family.
PubMed ID: 3335530
Title: Purification and characterization of two kinds of low molecular weight kininogens from rat (non-inflamed) plasma. One resistant and the second sensitive to rat glandular kallikreins.