HORDB

ID: hor006517
Uniprot ID: P01048
Protein name: T-kininogen 1 light chain
Gene name: Map1
Organism: Rattus norvegicus (Rat)
Family: NA
Source: Animal
Expression: In response to an inflammatory stimulant. T-kininogen II synthesis is induced and the plasma concentration of T-kininogen I is raised.|Plasma.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
GO BP: GO:0006953 acute-phase response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0030195 negative regulation of blood coagulation; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: LVRVQETKEGTTRLLNSCEYKGRLSKARAGPAPDHQAEASTVTP
Length: 44(387-430)
Propeptide: MKLITILLLCSRLLPSLAQEEGAQELNCNDETVFQAVDTALKKYNAELESGNQFVLYRVTEGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSVATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALREVKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPSLREDCVPLPYGDHGECTGHTHVDIHNTIAGFSQSCDLYPGDDL
Signal peptide: MKLITILLLCSRLLPSLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Kininogens are plasma glycoproteins with a number of functions: (1) as precursor of the active peptide bradykinin they effect smooth muscle contraction, induction of hypotension and increase of vascular permeability. (2) They play a role in blood coagulat
Mechanism: Rats express four types of kininogens: the classical HMW and LMW kininogens produced by alternative splicing of the same gene, and two additional LMW-like kininogens: T-I and T-II.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006517_AF2.pdb

hor006517_ESM.pdb

Mass:	553451	Formula:	C202H338N64O67S
Absent amino acids:	FIMW	Common amino acids:	AT
pI:	9.37	Basic residues:	8
Polar residues:	14	Hydrophobic residues:	12
Hydrophobicity:	-79.09	Boman Index:	-11291
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	66.59
Instability Index:	2260.68	Extinction Coefficient cystines:	1490
Absorbance 280nm:	34.65

PubMed ID: 2413018
Title: Primary structures of the mRNAs encoding the rat precursors for bradykinin and T-kinin. Structural relationship of kininogens with major acute phase protein and alpha 1-cysteine proteinase inhibitor.
PubMed ID: 2806908
Title: Primary structure of a gene encoding rat T-kininogen.#
PubMed ID: 2439509
Title:
PubMed ID: 3818598
Title:
PubMed ID: 2578992
Title:
PubMed ID: 3121623
Title:
PubMed ID: 2108948
Title:
PubMed ID: 7574705
Title:
PubMed ID: 3029068
Title:
PubMed ID: 3335530
Title: